Protein Model on 5xzx_A_1_B_1 (TEMPLATE: 5xzx )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [414 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [14 aa] Ran-binding protein 3 :RANB3_HUMAN 101R 105S 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 270D 273W 277Y 308P(K) 350N(K) (identity: 92.3 %/54.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5xzx_A_1 identity=54.3%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** *** :
5xzx_A_1       3:SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ: 102
SecStr          : HHHHHHHTT SSHHHHHHHHHHHHHTTSSSSS  HHHHHTTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S H:    
ExpBur          :eeeebeeebeeeeeeebeebbeebbeebeeeeeeebeebeeeebbebbbebbebeebeebbebbbebbbbbbeeeeebbebbbeeebbebbbebbebeee:    
Contact         :                        b   b    b                           b   b   b bbbbb  b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** ** *:
5xzx_A_1     103:NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALS: 198
SecStr          :HHHHHHHHHHHHHHTT HHHHHHHHHHT HHHHTTS S----TTS HHHHHHHHHHHHHHHH  SS   HHHHHHHHHHHHHHTT   HHHHHHHHHHHH:    
ExpBur          :ebbbbbbebbbbbbeebeebbeebbeeebbebbbebee----eebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbeeebeebbbebbebbb:    
Contact         :    b  b   b  bb                                   b  b   b  b                               b  b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH: 376
                :****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * *   :
5xzx_A_1     199:YLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA: 298
SecStr          :HHHHH HHHHHHHHHHT HHHHGGGGG S HHHHHHHHHHHHHHTTS HHHHHHHHTTT GGGSHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHTT:    
ExpBur          :ebbeeeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbeeeeebbeebbeeebbebbeebbeeeeeebbebbbbbbbebbebeeebbeebbee:    
Contact         :b                              b                                         b                          

queryA       377:GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL: 476
                : ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* *** *:
5xzx_A_1     299:NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQL: 396
SecStr          :T HHHHHHHHHHS HHHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHTTTTSS HHHHHHHHHHHHHHHHH ST--THHHHHHHHHHTTHHHHHHTT:    
ExpBur          :ebbeebbebbeeeeeebbebbbebbbbbbeebeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbeebee--eeeebbeebeeebbbeebeeb:    

queryA       477:QNHENESVYKASLSLIEKYF: 496
                :******  **     *   *:
5xzx_A_1     397:QNHENEDIYKLAYEIIDQFF: 416
SecStr          :  TT HHHHHHHHHHHHHH :    
ExpBur          :eeeeeeebeeebeebbeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123