Protein Model on 6bvv_A_1_B_1 (TEMPLATE: 6bvv )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [416 aa] Importin subunit alpha-3 :IMA3_HUMAN
2 b B 1 (B) polymer(polypeptide(L)) [24 aa] Protein W :W_NIPAV 105S 107E(D) 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 187G 188N 191G 192D 231W 235N 238R 270D 273W 277Y 311T 315R 321V 322T 323G 324T 325D 328T 353K 354E 357W 360S 361N 364A 365G 369Q 396E 399W 402T(S) 403N 406S(I) 442D 446N (identity: 93.5 %/54.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6bvv_A_1 identity=54.5%
queryA        77:SVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA: 176
                :*   **    * *   ** * ********    ****  *  *  *  *  * * *    *** *************** ***   * * *  ** *** :
6bvv_A_1      10:SLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQ: 109
SecStr          : HHHHHHHHTSS HHHHHHHHHHHHHHHHSSSS  HHHHHTTTHHHHHHHHTT TT HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S H:    
ExpBur          :eeeebbeebeeeeeeebeebbeebbeebeeeeeeebeebeeeebbebbbebbeeeebeebbbbbbebbbbbbeeeeebbeebbeeebbebbbebbebeee:    
Contact         :                            b b                              b   b   b bbbbb  b                     

queryA       177:HISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAIS: 276
                :   ********** ***   ** **  * * ***         *     *** **   **** * * **      *** *  * ** *   * ** ** *:
6bvv_A_1     110:NVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFIS----PSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALS: 205
SecStr          :HHHHHHHHHHHHHHHH HHHHHHHHHTT HHHHHTT S----TTS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHHT   HHHHHHHHHHHH:    
ExpBur          :ebbebbbebbbbbbeebbebbeebbeeebbebbbebbe----eebeeebbeebbebbbbbbeeeeeebeeebbeebbebbbebbeeebeebbbebbebbb:    
Contact         :    b  b  bb  bb                                      b   b  b                               b  b   

queryA       277:YLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNH: 376
                :****  ** * **   * ** ** **   *    * **** **************    **  ** *** **  * *** *  ****** * * * *   :
6bvv_A_1     206:YLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDA: 305
SecStr          :HHHTS HHHHHHHHHTT HHHHGGGGG SSHHHHHHHHHHHHHHTTS HHHHHHHHTTTGGGGSHHHHT S HHHHHHHHHHHHHHHTS HHHHHHHHHT:    
ExpBur          :bbbebeeebbebbbeeebbeebbebbeeeeeebbebbbebbbbbbebeeebbeebbeeebbebbeebbebeeeebbeebbebbbebbebeeebbeebbee:    
Contact         :b                                 b   b     bbbbb  b                        bb  b  bb  bb   b       

queryA       377:GLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEAL: 476
                : ***     * * ** ***** **  * *  *   *  **     * *  **** **     * **  ***   **   * *     ******* *** *:
6bvv_A_1     306:NLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAED--EAETIGNLIEECGGLEKIEQL: 403
SecStr          :T HHHHHHHHHHS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHGGGGSS HHHHHHHHHHHHHHHHH TT--THHHHHHHHHHTTHHHHHHHH:    
ExpBur          :ebbeebbebbeebeebbbebbbebbbbbbeebeeebbbebbeeebbebbbebbeeeeeebbbbbbebbbebbeebee--ebeebbeebeeeebbeebeeb:    
Contact         :                   b  b  bb  b                                   b   b                              

queryA       477:QNHENESVYKASLSLIEKYFS: 497
                :******  **     *   **:
6bvv_A_1     404:QNHENEDIYKLAYEIIDQFFS: 424
SecStr          :TT S HHHHHHHHHHHHHHS :    
ExpBur          :eeeeeeebeebbeebbeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123