Protein Model on 6d7m_A_1_F_1 (TEMPLATE: 6d7m )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [424 aa] Peroxidase,Importin subunit alpha-1 :IMA1_MOUSE
2 b F 1 (B) non-polymer(SIN) SUCCINIC ACID 77S 78V 79D(E) 103L 106R 114N (identity: 83.3 %/93.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6d7m_A_1 identity=93.9%
queryA        73:TVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 172
                :****** ******** * * ************************************* ******************************************:
6d7m_A_1      54:TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLA: 153
SecStr          : TT  HHHHHHHHHSS HHHHHHHHHHHHHHHH SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT:    
ExpBur          :eeeeeeeebeebbeeeeeeebbebbebbeebbeeeeeebbeebeeeebbebbbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebbe:    
Contact         :    bbb                       b  b       b                                                          

queryA       173:SPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTC: 272
                :*********** ********** ******* ** *********** * ********** ************** **************** ******* *:
6d7m_A_1     154:SPHAHISEQAVRALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTRTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSC: 253
SecStr          : S HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHTT S HHHHHHHH:    
ExpBur          :beeeebbbbbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbebb:    

queryA       273:WAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 372
                :************** **** ************ ************************ ******************************************:
6d7m_A_1     254:WAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ: 353
SecStr          :HHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHH:    
ExpBur          :ebbbbbbeeeeebbebbbeeebbebbbebbebeeeebbebbbebbbbbbebeeebbbebbeeebbeebeebbeeebeebeebbbbbbbebbebeeebbee:    

queryA       373:VVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 472
                :*********** ************* ** **************************** ******* **********************************:
6d7m_A_1     354:VVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK: 453
SecStr          :HHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHH  HHHHHHHHHTT HHHHHHGGGSS HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTHHHH:    
ExpBur          :bbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeebbbebbbebbebbbebbeeeeeeeebbeebeeeebeeb:    

queryA       473:IEALQNHENESVYKASLSLIEKYF: 496
                :***** *********** ******:
6d7m_A_1     454:IEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHHTS S HHHHHHHHHHHHHH :    
ExpBur          :beebeeeeeeebbeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123