Protein Model on 6d7n_A_1_D_1 (TEMPLATE: 6d7n )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (B) polymer(polypeptide(L)) [425 aa] Peroxidase,Importin subunit alpha-1 :A0A1S4NYF8_PANVG:IMA1_MOUSE
2 b D 1 (B) non-polymer(EDO) 1,2-ETHANEDIOL 91E 133C (identity: 100.0 %/93.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6d7n_A_1 identity=93.9%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
6d7n_A_1      53:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 152
SecStr          :  SS  HHHHHHHHTSS HHHHHHHHHHHHHHHT SS   HHHHHHTTHHHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeebeeeebeebbeeeeeeebbebbebbeebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbeebbebb:    
Contact         :                   b                                         b                                      

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
6d7n_A_1     153:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 252
SecStr          :T S HHHHHHHHHHHHHHHHH HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHT   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbbbbbebbbbbbeeebebbeebbeeebbeebbeebeeeebeeeeeebbeebbbbbbbbbeeeeeebeeebbeebbebbeebbebebeebbbbb:    

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ ************************** **************:
6d7n_A_1     253:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATRTMSNITAGRQDQIQ: 352
SecStr          :HHHHHHHHSS HHHHHHHHHTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHH:    
ExpBur          :bbbbbbbbeeeeebbebbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbebbeeebbeebeebbebebeebbebbbebbbebbebeeebbe:    

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ *************  * **************************** ******* *********************************:
6d7n_A_1     353:QVVNHGLVPFLVGVLSKADFKTQKEAARAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 452
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbbbbbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebbebebee:    

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
6d7n_A_1     453:KIEALQRHENESVYKASLNLIEKYF: 477
SecStr          :HHHHHTS SSHHHHHHHHHHHHHH :    
ExpBur          :ebeebeeeeeeebbeebeebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123