Protein Model on 6iua_A_1_B_1 (TEMPLATE: 6iua )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [422 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b B 1 (B) polymer(polypeptide(L)) [22 aa] Peptide from TP53-binding protein 1 :TP53B_HUMAN 105S 106R 107E 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 235N 238R 270D 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 357W 360S 361N 364A 396E 399W 403N (identity: 100.0 %/94.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6iua_A_1 identity=94.3%
queryA        75:NWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 174
                :**** ******** * * ************************************* ********************************************:
6iua_A_1       4:NWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASP: 103
SecStr          :   HHHHHHHHTT  HHHHHHHHHHHHHHHT SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S:    
ExpBur          :eeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbbbbbebbbbbbeeeeebbebbbeeebbebbbebbebe:    
Contact         :                              bbb                              b   b   b bbbbb  b                   

queryA       175:HAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWA: 274
                :******************** ******* ** *********** * ************************* **************** ******* ***:
6iua_A_1     104:HAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWA: 203
SecStr          : HHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHTT SS GGGS HHHHHHHHHHHHHHH   SS   HHHHHHHHHHHHHHHT S HHHHHHHHHH:    
ExpBur          :eeebbebbbebbbbbbeebeebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbbebbebebeebbbebbeb:    
Contact         :      b  b   b  bb                                      b   b  b                               b    

queryA       275:ISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 374
                :************ **** ************ ************************ ********************************************:
6iua_A_1     204:ISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVV: 303
SecStr          :HHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHHTS HHHHHHHH:    
ExpBur          :bbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbebeeeebbebbbebbbebbebeeebbeebb:    
Contact         :     bb b  b                            b   b bbb    b                            b  bb  b          

queryA       375:NHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 474
                :********* ************* ** **************************** ******* ************************************:
6iua_A_1     304:NHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIE: 403
SecStr          :HTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHHHHH:    
ExpBur          :eeebbeebbebbeeeeeebbeebbebbbebbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbeebe:    
Contact         :                     b  b   b                                                                       

queryA       475:ALQNHENESVYKASLSLIEKYF: 496
                :*** *********** ******:
6iua_A_1     404:ALQRHENESVYKASLNLIEKYF: 425
SecStr          :HHTT SSHHHHHHHHHHHHHH :    
ExpBur          :ebeeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123