Protein Model on 6iw8_B_1_A_1 (TEMPLATE: 6iw8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (C) polymer(polypeptide(L)) [419 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b A 1 (A) polymer(polypeptide(L)) [28 aa] Peptide from Golgin subfamily A member 2 :GOGA2_HUMAN 105S 106R 107E 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 228N 231W 235N 238R 273W 277Y 280D 281G 283N 286I 315R 319N 321V 322T 323G 328T 350N 353K 354E 357W 361N 364A 392K 396E 399W (identity: 100.0 %/93.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6iw8_B_1 identity=93.6%
queryA        76:WSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH: 175
                :*** ********   * ************************************* *********************************************:
6iw8_B_1      11:WSVEDIVKGINSNXLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPH: 110
SecStr          :  HHHHHHHHTT - HHHHHHHHHHHHHHT SS   HHHHHHTTHHHHHHHHTT SS HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT SS:    
ExpBur          :eeeeebeebbeee-eeebbebbebbbebbeeeeeeebeebeeeebbeebbebbebeebbebbebbbebbbebbeeeeebbeebbeeebbeebbebbeeee:    
Contact         :                             bbb                                  b   b bbbbb  b                    

queryA       176:AHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAI: 275
                :******************* ******* ** *********** * ******************* ***** **************** ******* ****:
6iw8_B_1     111:AHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNXNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAI: 210
SecStr          :HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHTT  S GGGS HHHHHHHHHHHHHHT  -     HHHHHHHHHHHHHHTTSS HHHHHHHHHHH:    
ExpBur          :eebbebbbebbbbbbeeeeebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbee-eeebeeebbeebbebbbebbeeebeebbbebbebb:    
Contact         :     b  b   b  bb                                   b  b   b  b                                  b  

queryA       276:SYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN: 375
                :*********** **** ************ ************************ *********************************************:
6iw8_B_1     211:SYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVN: 310
SecStr          :HHHTSSSHHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHH:    
ExpBur          :bbbbeeeeebbeebbeeebbebbbebbeeeeeebbebbbebbbbbbeeeeebbbebbeeebbebbeebbeeeeeebbbbbbebbbebbeeeeebbeebbe:    
Contact         : b  bb b  b                            b   b bbb    b                     b  bb  b   b  b           

queryA       376:HGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA: 475
                :******** ************* ** **************************** ******* *************************************:
6iw8_B_1     311:HGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEA: 410
SecStr          :TTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTT   HHHHHHHHHHHHHHHHHHHHHT HHHHHHHHHHTTHHHHHHH:    
ExpBur          :eebbeebbebbeeeeeebbbebbebbbebbeebebebbbebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeeeeebbeebeeeebbeebee:    
Contact         :                b   b  b                                                                            

queryA       476:LQNHENESVYKASLSLIEKYFS: 497
                :** * ********* *******:
6iw8_B_1     411:LQRHXNESVYKASLNLIEKYFS: 432
SecStr          :TT  - HHHHHHHHHHHHHH  :    
ExpBur          :beee-eeebbeebeebeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123