Protein Model on 6iwa_B_1_A_1 (TEMPLATE: 6iwa )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (C) polymer(polypeptide(L)) [427 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b A 1 (A) polymer(polypeptide(L)) [28 aa] PHOSPHOSERINE GM130 :GOGA2_HUMAN 105S 106R 107E 110P 138F 142W 146N 148A 149S 150G 151T 152S 155T 181Q 184W 188N 191G 192D 231W 235N 238R 239N 240K 273W 277Y 280D 281G 283N 286I 311T 315R 319N 321V 322T 323G 325D 328T 350N 353K 354E 357W 361N 392K 396E 399W 433D (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6iwa_B_1 identity=94.4%
queryA        71:QGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 170
                :******** ******** * * ************************************* ****************************************:
6iwa_B_1       6:QGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISL: 105
SecStr          : TTSS  HHHHHHHHTSS HHHHHHHHHHHHHHHH SS   HHHHHHTT HHHHHHHHT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHH:    
ExpBur          :eebeeeeeeebeebbeeeeeeebbebbebbbebbeeeeeebbeebeeeebbeebbebbeeeebeebbebbbebbbbbbeeeeebbebbbeeebbeebbeb:    
Contact         :                                  bbb  b                           b   b   b bbbbb  b               

queryA       171:LASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLAD: 270
                :************************ ******* ** *********** * ************************* **************** *******:
6iwa_B_1     106:LASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLAD: 205
SecStr          :TT S HHHHHHHHHHHHHHHHT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHT   TT   HHHHHHHHHHHHHHTTSS HHHHHH:    
ExpBur          :bebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeebeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbb:    
Contact         :          b  b   b  bb                                      b   b  bbb                              

queryA       271:TCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 370
                : *************** **** ************ ************************ ****************************************:
6iwa_B_1     206:SCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQI: 305
SecStr          :HHHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGGHHHHTT SSHHHHHHHHHHHHHHTTS HHHH:    
ExpBur          :bbebbbbbbeeeeebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbebeeebbbebbeeebbebbeebbeeeeeebbebbbebbbebbebeeebb:    
Contact         :  b   b  bb b  b                        b   b   b bbb b  b                     b  bb  b   b         

queryA       371:QQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 470
                :************* ************* ** **************************** ******* ********************************:
6iwa_B_1     306:QQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGL: 405
SecStr          :HHHHHTTHHHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHHTTSS HHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHTTHH:    
ExpBur          :eebbeeebbeebbebbeeeeeebbbebbebbbbbbeebeeebbbebbeeebbebbbebbeeeeeebbebbbebbebbbebbeeeeebeebbeebeebebe:    
Contact         :                     b   b  b                                 b                                     

queryA       471:DKIEALQNHENESVYKASLSLIEKYFS: 497
                :******* *********** *******:
6iwa_B_1     406:DKIEALQRHENESVYKASLNLIEKYFS: 432
SecStr          :HHHHHGGGSS HHHHHHHHHHHHHH  :    
ExpBur          :eebeebeeeeeeebeebbeebbeebbe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123