Protein Model on 6kbn_A_1_B_1 (TEMPLATE: 6kbn )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [498 aa] Vacuolar protein 8 :VAC8_YEAST
2 b B 1 (B) polymer(polypeptide(L)) [21 aa] Autophagy-related protein 13 :ATG13_YEAST 272C 273W(A) 276S(G) 277Y(N) 280D(V) 312P(N) 315R(G) 316A(C) 318G(T) 319N 322T 350N(R) 354E(N) 357W(G) 360S(L) 361N 364A(H) 395K(Y) 396E(Y) 399W(T) 403N (identity: 23.8 %/27.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6kbn_A_1 identity=27.3%
queryA       251:QILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTN: 350
                :  *     **   **      * *   *    **     *  *    *              *   * *  *  *         ***     *       :
6kbn_A_1      70:EVLEPILILLQSQDPQIQVAACAALGNLAVN-NENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIAT-SGALIPLTKLAKSKHIR: 167
SecStr          :HHHHHHHHHHSS  HHHHHHHHHHHHHHTTS-HHHHHHHHHHT HHHHHHHHHSS HHHHHHHHHHHHHTT SHHHHHHHHT-TTTHHHHHHHTT SSHH:    
ExpBur          :ebbebbbebbeeebeebbebbbebbbebbee-eebbebbbeeebbebbbebbeeeeeebbbebbbbbbebbeeeebbeebbe-eebbebbbebbebeeee:    
Contact         :                     bb  bb  b                               b  bb bb  b                           b

queryA       351:IQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTN: 403
                : *  **    * *          ** * ** *** **  *   *     *  *:
6kbn_A_1     168:VQRNATGALLNMTHSEENR-KELVNAGAVPVLVSLLSSTDPDVQYYCTTALSN: 219
SecStr          :HHHHHHHHHHHTTSSHHHH-HHHHTTT HHHHHHHTT SSHHHHHHHHHHHHH:    
ExpBur          :bbeebbbbbbebbebeebb-eebbebebbebbbebbebebeebbeebbbbbbe:    
Contact         :   b  b  bb  b                              bb  b   b                                               


Input Residue Numbers for Focused Sites

ex) 2,15,123