Protein Model on 6s9l_A_1_C_1 (TEMPLATE: 6s9l )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [285 aa] KR4KLSF Lock1
2 b C 1 (C) polymer(polypeptide(L)) [12 aa] LYS-ARG-LYS-ARG-LYS-ARG-LYS-ARG-LYS-LEU-SER-PHE 142W 145T(R) 148A 149S 150G 155T(I) 184W(G) 187G(S) 188N 191G(S) 192D(G) 197R(I) 231W 234S 235N 238R(S) 239N(G) 246I 270D(E) 273W 276S 277Y(N) 280D(S) 281G 282P(G) 286I 312P(E) 315R(W) 318G(S) 319N 322T(S) 354E 357W 361N (identity: 50.0 %/40.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9l_A_1 identity=40.3%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *    * * *****  **  ** * ** **   ** **   *   *  ** ***  *      **  **   *  **  *    :
6s9l_A_1       6:LPQMVQQLNSPDQQELQ-SALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 104
SecStr          :HHHHHHHTT SSHHHHH-HHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHH:    
ExpBur          :beebbeebebeeeeebe-ebbeebeeebeeeeeebeebbeeebbebbbebbebeeeebbbbbbbbbbebbebbeebbbebbeeebbebbbebbeeeeeeb:    
Contact         :                     b  b  bbb    b                            b  bb  bb    b                       

queryA       221:LACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :*         * ***     *    * **     ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
6s9l_A_1     105:LQLAL-----WALSNIASGGNEQ--IQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :HHHHH-----HHHHHHTTS HHH--HHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :beebb-----ebbbebbebbeeb--bbbbbeeebbeebbebbeeeeeebbbbbbebbbebbebeeebbbbbbeeebbebbbebbebebeebbebbbebbb:    
Contact         :          b  bb  bb      b                         b  b  bb  bbb   b                         b  b  b

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
6s9l_A_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHTS :    
ExpBur          :ebbebeeebbebbbeeebbeebbebbebeeeebbbbbbebbbebbebeeebbebbeeeebeebbeebeebeeeebeeebeebbeebee:    
Contact         :b  b                               b  b   b                                                         


Input Residue Numbers for Focused Sites

ex) 2,15,123