Protein Model on 6s9l_B_1_I_1 (TEMPLATE: 6s9l )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [283 aa] KR4KLSF Lock1
2 b I 1 (B) non-polymer(MPD) (4S)-2-METHYL-2,4-PENTANEDIOL 303G(S) (identity: 0.0 %/40.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9l_B_1 identity=40.3%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *    * * *****  **  ** * ** **   ** **   *   *  ** ***  *      **  **   *  **  *    :
6s9l_B_1       6:LPQMVQQLNSPDQQELQ-SALWKLRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 104
SecStr          :HHHHHHHTT S HHHHH-HHHHHHHHHHTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHH:    
ExpBur          :eeebbebbebeeeeebe-ebbeebeebbeeeeeebeebbeeebbebbbebbebeeeebbbbbbebbbebbebeeebbbebbeeebbebbbebbebeeeeb:    

queryA       221:LACGYLRNLTWTLSNLCR--NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIG: 318
                :*         * ***     *      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  :
6s9l_B_1     105:LQLAL-----WALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALS: 197
SecStr          :HHHHH-----HHHHHHTTS HHHHHHHHHT--T HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHH:    
ExpBur          :bebbb-----ebbbebbebeeebbbbbbee--ebbeebbebbebeeeebbbbbbebbbbbbebeeebbebbbeeebbebbbebbeeeeeebbbbbbebbb:    
Contact         :                                                                                    b               

queryA       319:NIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTS: 406
                :**  *  ** * *******     **  *   *  ** *  ***  *   * * *   *    *    *    * ****  *     *:
6s9l_B_1     198:NIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :HHHTS HHHHHHHHHTT HHHHHHHTT SSHHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHT :    
ExpBur          :ebbebbeebbbebbeeebbebbbebbebeeeebbebbbebbbbbbebbeebbebbeeeebeebbeebeeeeeeebeeebeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123