Protein Model on 6s9n_A_1_G_1 (TEMPLATE: 6s9n )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [300 aa] Lock2_KRKRKAKLSF
2 b G 1 (A) non-polymer(CA) CALCIUM ION 305S(P) 307L(E) (identity: 0.0 %/40.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9n_A_1 identity=40.3%
queryA       253:LPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQ: 352
                :** ** **       **    *      * ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   * :
6s9n_A_1      48:LPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALIALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQIL: 147
SecStr          :HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHH:    
ExpBur          :bebbbebbebeeeebbbbbbbbbbbbbbbbeebbbebbeeebbeebbebbeeeeeebbbbbbbbbbbbbbbeeebbbbbbeeebbeebbebbeeeeeebb:    
Contact         :                                                    b b                                             

queryA       353:KEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAE: 452
                : ** *  ***  *   *** *   *  * **  **        ** **  *  ***  ***      *    *  **      *    * * ***     :
6s9n_A_1     148:QEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG--: 244
SecStr          :HHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS--:    
ExpBur          :bbbbbbbbbbbbbbeebbebbbeeebbeebbebbebeeeebbebbbbbbbbbbbbee-ebbbbbbeeebbebbbebbebeeeebbebbbebbbbbbbb--:    

queryA       453:KLGETEKLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :  *   *      * * * * * ** ****   *      **  *:
6s9n_A_1     245:--GNEQKQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 285
SecStr          :-- HHHHHH--HHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHT :    
ExpBur          :--beebbeb--beeeebeeebeebeeeeeeebeebbeebbebbee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123