Protein Model on 6s9o_A_1_M_1 (TEMPLATE: 6s9o )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [340 aa] designed Armadillo repeat protein with internal Lock1 fused to target peptide KRKRKLKFKR
2 b M 1 (A) non-polymer(EDO) 1,2-ETHANEDIOL 381F(A) 384S(Q) 385V(L) (identity: 0.0 %/37.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9o_A_1 identity=37.8%
queryA       161:GGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVR: 258
                :*   *     * **       *   *  **  *      **  **   *  **  *         *    * ***     *    * **     ** ** :
6s9o_A_1       3:GSELPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQ--IQAVIDAGALPALVQ:  95
SecStr          :  SHHHHHHHHT S HHHHHHHHHHHHHHHSS HHHHHHHHHTT HHHHHHHTT S HH-----HHHHHHHHHHHHTTS HHH--HHHHHHTT HHHHHH:    
ExpBur          :eeeeeebbeebeeeeeeebbebbeebbebbeeeeeebeebbeeebbebbbebbebeeee-----bbbbbbebbbbbbbbeeeb--beebbeeebbebbbe:    

queryA       259:LLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT: 358
                :**       *    **      * ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *   * * :
6s9o_A_1      96:LLSSPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQLALWA: 195
SecStr          :HHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHH:    
ExpBur          :bbebeeeebbbbbbbbbbbbbbbeeebbeebbeeebbebbeebbebeeeebbbbbbbbbbbbbbbeeebbebbbeeebbeebbebbeeeeeebbebbbbb:    

queryA       359:MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETE: 458
                : ***  *   *** *   *  * **  **        ** **  *  ***  ***      *    *  **      *    * * ***       *   :
6s9o_A_1     196:LSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQ: 290
SecStr          :HHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTSS---- HHH:    
ExpBur          :bbbbbbbeeebbeebbeeebbeebbeebeeeeeebbebbbbbbbbbbbbee-ebbebbbeeebbebbbebbeeeeeebbebbbebbbbbbee----beeb:    
Contact         :                      b  bb                                                                         

queryA       459:KLSIMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :*      * * * * * ** ****   *      **  *:
6s9o_A_1     291:KQA--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 327
SecStr          :HHH--HHHTTHHHHHHHHTT SSHHHHHHHHHHHHHHHS:    
ExpBur          :beb--beeeebeeebeebeeeeeeebeeebeebbeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123