Protein Model on 6s9o_E_1_DA_1 (TEMPLATE: 6s9o )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:5]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) E 1 (E) polymer(polypeptide(L)) [341 aa] designed Armadillo repeat protein with internal Lock1 fused to target peptide KRKRKLKFKR
2 b DA 1 (E) non-polymer(EDO) 1,2-ETHANEDIOL 490S(E) (identity: 0.0 %/37.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9o_E_1 identity=37.8%
queryA       164:IPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAV--EQILPTLVRLLH: 261
                : *     * **       *   *  **  *      **  **   *  **  *         *    * ***     *    * **     ** ** ** :
6s9o_E_1       6:LPQMVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNE--QIQAVIDAGALPALVQLLS:  98
SecStr          :HHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S HH-----HHHHHHHHHHHHTTS HH--HHHHHHHTTHHHHHHHHHT:    
ExpBur          :beebbeebeeeeeeebbbbbeebbeebbeeeeebeebbeeebbebbbebbeeeeee-----bbeebbebbbbbbbbeee--bbbebbeeebbeebbebbe:    

queryA       262:HDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSN: 361
                :      *    **      * ** *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *   * *  **:
6s9o_E_1      99:SPNEQILQEALWALRNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQLALWALSN: 198
SecStr          : S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHH:    
ExpBur          :eeeeebbebbbebbbbbbbbeeebbebbbeeebbebbbebbeeeeeebbbbbbbbbbbbbbbeeebbebbbeeebbeebeebbeeeeeebbebbbbbbbb:    

queryA       362:ITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLS: 461
                :*  *   *** *   *  * **  **        ** **  *  ***  ***      *    *  **      *    * * ***       *   *  :
6s9o_E_1     199:IASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG----GNEQKQA: 293
SecStr          :HTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTTS H-HHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHTSS---- HHHHHH:    
ExpBur          :bbbbbeebbebbbeeebbeebbebbeeeeeebbebbbbbbbbbbbbee-ebbebbbeeebbeebbebbeeeeeebbbbbbebbbbbbbb----beebbee:    

queryA       462:IMIEECGGLDKIEALQNHENESVYKASLSLIEKYFS: 497
                :    * * * * * ** ****   *      **  *:
6s9o_E_1     294:--VKEAGALEKLEQLQSHENEKIQKEAQEALEKLQS: 327
SecStr          :--HHHTTHHHHHHHTTSSS HHHHHHHHHHHHHHT :    
ExpBur          :--beeeebeeebeebeeeeeeebbebbeebbebbee:    
Contact         :                            b                                                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123