Protein Model on 6s9p_A_1_B_1 (TEMPLATE: 6s9p )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [338 aa] internal Lock2 fused to target peptide KRKAKITWKR
2 b B 1 (B) polymer(polypeptide(L)) [334 aa] internal Lock2 fused to target peptide KRKAKITWKR 392K(Q) 432K(E) 433D(N) 434T(E) 435K (identity: 20.0 %/39.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6s9p_A_1 identity=39.5%
queryA       121:IPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSS: 220
                : *  *  *   *    *      *  ****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *    :
6s9p_A_1       6:LPQMVQQLNSPDQQELQ-SALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI: 104
SecStr          : HHHHHGGG S HHHHH-HHHHHHHHHHTS HHHHHHHHTTT HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHGGG S HHH:    
ExpBur          :eeebbeebebeeeeebe-ebbeebbeebeeeeeebeebbeeebbeebbebbebeeeebbbbbbebbbbbbebeeebbeebbeeebbebbbebbeeeeeeb:    

queryA       221:LACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNI: 320
                :*    ** *         *      ***    ** ** **       **    *      * ** *  *   *  * ** **      *   ** *  **:
6s9p_A_1     105:LQEA-LRALQQI--AMGGNEQIQAVIDAG--ALPALVQLLSSPNEQILASALGALANIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQFALIALSNI: 199
SecStr          :HHHH-HHHHHHH--TTS HHHHHHHHHTT-- HHHHHHHTT S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHH:    
ExpBur          :bebb-bbbbbbb--bebeeebbbebbeee--bbeebbebbebeeeebbbbbbbbbbbbbbbbeebbeebbeeebbebbbebbebeeeebbbbbbbbbbbb:    

queryA       321:VTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCG: 420
                :  *  ** * *******     **  *   *  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  **       *:
6s9p_A_1     200:ASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAG: 298
SecStr          :TTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHHHHHTSS H-HHHHHHHHTT:    
ExpBur          :bbbbeebbbbbbeeebbeebbebbeeeeeebbebbbbbbbbbbbbeeebbebbbeeebbeebbebbeeeeeebbbbbbebbbbbbbbbe-ebbebbeeee:    
Contact         :                                                                       b                            

queryA       421:IIEPLMNLLTAKDTKI: 436
                :  * *  *      **:
6s9p_A_1     299:ALEKLEQLQSHENEKI: 314
SecStr          :HHHHHHHGGG SSHHH:    
ExpBur          :beeebeebeebeeeeb:    
Contact         :           bbbb                                                                                     


Input Residue Numbers for Focused Sites

ex) 2,15,123