Protein Model on 6sa7_B_1_A_1 (TEMPLATE: 6sa7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [499 aa] DARPin-Armadillo fusion C8long83
2 b A 1 (A) polymer(polypeptide(L)) [499 aa] DARPin-Armadillo fusion C8long83 283N 325D(N) 367Q(N) 409T(N) (identity: 25.0 %/42.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6sa7_B_1 identity=42.2%
queryA       142:WALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKN: 241
                :* * *****  **  ** * ** **   ** **   *   * *** ***  *      **  **   *  **  *         *    * ***     *:
6sa7_B_1     195:WTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGN: 289
SecStr          :HHHHHHHHT HHHHHHHHHHTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTT HHHHHHHTT S HH-----HHHHHHHHHHHHHTS H:    
ExpBur          :eebbeebeebeeebebbbeeebbebbeebbebeeeebbeebbebbbbbbbbeeebbbbbbeeebbeebeebbebeeee-----bbebbbbbbbbbbbbbe:    

queryA       242:PA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAV: 339
                :      ***    ** ** **       *    ** *    * ** *  *   *  * ** **      *   ** *  **  *  ** * *******  :
6sa7_B_1     290:EQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPA: 387
SecStr          :HHHHHHHHT--THHHHHHHHTT S HHHHHHHHHHHHHHHSS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHH:    
ExpBur          :ebbebbbee--ebbebbeebbebeeeebbbbbbbbbbbbbbbbeebbebbbeeebbeebeebbebeeeebbbbbbbbbbbbbebbeebbebbbeeebbeb:    
Contact         :                                           b                                         b              

queryA       340:FPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKI: 436
                :   **  *   *  ** *  ***  *   *** *   *  * **  **        ** **  *  ***  **       *  * *  *      **:
6sa7_B_1     388:LVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGN-EQKQAVKEAGALEKLEQLQSHENEKI: 483
SecStr          :HHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTHHHHHHHHTT S HHHHHHHHHHHHHHHTS H-HHHHHHHHTTHHHHHHHGGG SSHHH:    
ExpBur          :beebbebeeeebbbbbbebbbbbbebbeebbebbbeeebbebbbebbebeeeebbbbbbebbbebbebbe-ebbebbeeeebeeebeebeebeeeeb:    
Contact         :                           b                                         b                              


Input Residue Numbers for Focused Sites

ex) 2,15,123