Protein Model on 6sa8_A_1_B_1 (TEMPLATE: 6sa8 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) A 1 (A) polymer(polypeptide(L)) [665 aa] ring-like DARPin-Armadillo fusion H83_D01
2 b B 1 (B) polymer(polypeptide(L)) [10 aa] LYS-ARG-LYS-ARG-LYS-ARG-LYS-ARG-LYS-ARG 149S 150G 184W 187G(S) 188N 191G(S) 192D(G) 197R(I) 228N(E) 231W 234S 235N 238R(S) 239N(G) 270D(E) 273W 276S 277Y(N) 280D(S) 281G 282P(G) 283N 312P(E) 315R(W) 318G(S) 319N 321V(A) 322T(S) 323G 328T(I) 354E 357W 360S 361N 364A(S) 396E (identity: 50.0 %/39.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6sa8_A_1 identity=39.9%
queryA        87:SSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWAL: 186
                :**  ** **                *   * **  *  *  *        * *  *** *****  **  ** * ** **   ** **   *   * ***:
6sa8_A_1     188:SSPNENELQNALWTLGNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQ-EALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWAL: 286
SecStr          :T S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHGGG S HHHHH-HHHHHHHHHTTS HHHHHHHHHTT HHHHHHHTT S HHHHHHHHHHH:    
ExpBur          :ebeeeeebbebbeebbeebeeeeeebeebbeeebbebbbebbebeeeebbe-bbbebbbbbbebeeebbeebbeeebbeebbebbebeeeebbebbbebb:    
Contact         :                                                              bb                                 b  

queryA       187:GNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPA--PPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNE: 284
                : ***  *      **  **   *  **  *         *    * ***     *      ***    ** ** **       *    ** *    * **:
6sa8_A_1     287:SNIASGGNEQIQAVIDAGALPALVQLLSSPNEQ-----ILQEALWALSNIASGGNEQIQAVIDA--GALPALVQLLSSPNEQILQEALWALSNIASGGNE: 379
SecStr          :HHHTTS HHHHHHHHHTTHHHHHHHHTT S HH-----HHHHHHHHHHHHTTS HHHHHHHHHT--THHHHHHHHTT S HHHHHHHHHHHHHHTTS HH:    
ExpBur          :bebbebeeebbbebbeeebbeebbebbeeeeee-----bbbbbbebbbbbbebeeebbebbbee--ebbebbbebbebeeeebbbbbbebbbbbbebeee:    
Contact         :bb  bb    b                              b  b  bb  bb    b                           b  b  bb  bbbb 

queryA       285:RIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVS: 384
                : *  *   *  * ** **      *   ** *  **  *  ** * *******     **  *   *  ** *  ***  *   *** *   *  * ** :
6sa8_A_1     380:QIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQ: 479
SecStr          :HHHHHHHTTHHHHHHHGGG S HHHHHHHHHHHHHHTTS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHH:    
ExpBur          :bbebbbeeebbeebbebbebeeeebbbbbbebbbbbbebeeebbbbbbeeebbeebbebbebebeebbbbbbebbbebbebeeebbebbbeeebbebbbe:    
Contact         :                           b  b  bb bbb    b                         b  b  bb  b                    

queryA       385:VLSKADFKTQKEAVWAVTNYTSGGTVEQ: 412
                : **      * **     *   *    *:
6sa8_A_1     480:LLSSPNEQIQDEAEKTLLNIANGSEEQQ: 507
SecStr          :HTT S HHHHHHHHHHHHHHHTS HHHH:    
ExpBur          :bbebebeebbeebbebbebbbeeeeebe:    
Contact         :           b                                                                                        


Input Residue Numbers for Focused Sites

ex) 2,15,123