Protein Model on 7jk7_B_1_D_1 (TEMPLATE: 7jk7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IMA1_HUMAN) B 1 (B) polymer(polypeptide(L)) [425 aa] Importin subunit alpha-1 :IMA1_MOUSE
2 b D 1 (B) non-polymer(GOL) GLYCEROL 76W 80D (identity: 100.0 %/94.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jk7_B_1 identity=94.4%
queryA        72:GTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 171
                :******* ******** * * ************************************* *****************************************:
7jk7_B_1      11:GTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLL: 110
SecStr          :  SS  HHHHHHHHHSS HHHHHHHHHHHHHHHHH SS  HHHHHHTT HHHHHHHTT TT HHHHHHHHHHHHHHHTS HHHHHHHHHTTHHHHHHHHT:    
ExpBur          :ebeebeeeebeebbeeeeeeebbebbebbbbbbeeeeeebbeebeeeebbeebbebbeeeebbebbbbbbebbbbbbeeeeebbebbbeeebbebbbebb:    
Contact         :    b   b                                                                                           

queryA       172:ASPHAHISEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDAVEQILPTLVRLLHHDDPEVLADT: 271
                :*********************** ******* ** *********** * ************************* **************** ******* :
7jk7_B_1     111:ASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADS: 210
SecStr          :T SSHHHHHHHHHHHHHHHTT HHHHHHHHHTT HHHHHHHT SS GGGS HHHHHHHHHHHHHHS   SS   HHHHHHHHHHHHHHTT S HHHHHHH:    
ExpBur          :ebeeeebbebbbebbbbbbeebbebbeebbeeebbeebbeebeeeebeeeeeebbebbbebbbbbbeeeeeebeeebbeebbebbeebbebebeebbbeb:    

queryA       272:CWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 371
                :*************** **** ************ ************************ *****************************************:
7jk7_B_1     211:CWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQ: 310
SecStr          :HHHHHHHTSS HHHHHHHHTTT HHHHHHHHT S HHHHHHHHHHHHHHTTS HHHHHHHHHTTGGGG  - TT SSHHHHHHHHHHHHHHTTS HHHHH:    
ExpBur          :bebbbbbbeeeeebbebbbeeebbebbbebbebeeeebbbbbbebbbbbbebeeebbbebbeeebbeebe-bbeeeeeebebbbbbbbbebbebeeebbe:    

queryA       372:QVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 471
                :************ ************* ** **************************** ******* *********************************:
7jk7_B_1     311:QVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLD: 410
SecStr          :HHHHTT HHHHHHHHHSS HHHHHHHHHHHHHHHHHS HHHHHHHHHTT HHHHHHGGG S HHHHHHHHHHHHHHHHHHHTTT HHHHHHHHHHTTHHH:    
ExpBur          :ebbeeebbeebbebbeeeeeebbeebbebbbbbbeebeeebbeebbeeebbebbbebbebeeeebbebbbebbbbbbebbeeeeeeeebbeebeebebee:    

queryA       472:KIEALQNHENESVYKASLSLIEKYF: 496
                :****** *********** ******:
7jk7_B_1     411:KIEALQRHENESVYKASLNLIEKYF: 435
SecStr          :HHHHTTS SSHHHHHHHHHHHHHH :    
ExpBur          :ebeebbeeeeeebeeebeebbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123