Protein Model on 1alu_A_1_A_2 (TEMPLATE: 1alu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [157 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b A 2 (A) polymer(polypeptide(L)) [157 aa] INTERLEUKIN-6 :IL6_HUMAN 127E 130Q 131N 141R 144Q 145M 148K 149V 152Q 153F 155Q 156K 158A 159K 161L 162D 163A 164I 166T 168D 169P 170T (identity: 100.0 %/94.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1alu_A_1 identity=94.6%
queryA        47:LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 146
                :*********************************         **********************************************************:
1alu_A_1      21:LTSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 120
SecStr          :  HHHHHHHHHHHHHHHHHHHHHHHHHHH    ---------        GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHHHH STTHHHHHHHHHH:    
ExpBur          :eeeeeebeebbeebbeebeebeebbbeebebbe---------ebebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbeebeebeeebeebbeb:    
Contact         :                                                                                b  bb         b  bb 

queryA       147:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :******************************************************************:
1alu_A_1     121:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHHTSSS       HHHHHHHHHHHHTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :beebbebbeeebeeeeebeeeeeeeeeeebeebeeeeeeebeebbbebbebbeebbeebbebbeee:    
Contact         : bb  bb bb bb bbbb b bbb                                                                            


Input Residue Numbers for Focused Sites

ex) 2,15,123