Protein Model on 1alu_A_3_B_3 (TEMPLATE: 1alu )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 3 (A) polymer(polypeptide(L)) [157 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b B 3 (A) non-polymer(SO4) SULFATE ION 102F 103Q 207R (identity: 100.0 %/94.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1alu_A_3 identity=94.6%
queryA        47:LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 146
                :*********************************         **********************************************************:
1alu_A_3      21:LTSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 120
SecStr          :  HHHHHHHHHHHHHHHHHHHHHHHHHHH    ---------        GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHHHH STTHHHHHHHHHH:    
ExpBur          :eeeeeebeebbeebbeebeebeebbbeebebbe---------ebebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbeebeebeeebeebbeb:    
Contact         :                                                       bb                                           

queryA       147:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :******************************************************************:
1alu_A_3     121:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHHTSSS       HHHHHHHHHHHHTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :beebbebbeeebeeeeebeeeeeeeeeeebeebeeeeeeebeebbbebbebbeebbeebbebbeee:    
Contact         :                                                            b                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123