Protein Model on 1i1r_B_1_A_1 (TEMPLATE: 1i1r )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) B 1 (B) polymer(polypeptide(L)) [167 aa] VIRAL IL-6 :Q98823_HHV8
2 b A 1 (A) polymer(polypeptide(L)) [301 aa] INTERLEUKIN-6 RECEPTOR BETA CHAIN :IL6RB_HUMAN 55K(Q) 56Q(R) 59Y(W) 62D(W) 138E(I) 141R(D) 142A(V) 145M(L) 149V(T) 152Q(W) (identity: 0.0 %/26.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1i1r_B_1 identity=26.5%
queryA        55:KQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFL: 154
                :      *  *       *     *    *  *   * **     * *   ****  ** *   *  ****    *   *  *          ** *    :
1i1r_B_1      14:QRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDI: 113
SecStr          :HHHHHHHHHHHHHHHHHHHHH  BTTTB   S   S      STT  SSSS  HHHHHHHHHHHHHHHHHHHHHHHHHHTTTSTTGGGHHHHHHHHHHHH:    
ExpBur          :ebbeebeebbeebbebbeeebebbeeeeebeeeeeeebbebeeebebeeeeeeeeebbebbbbbbbebbbbbebbeebbeeebeebeebbebbeebbeeb:    
Contact         :bb  b  b                                                                           b  bb  b   b  b  

queryA       155:QKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL: 209
                :*     *       *     **  **    *         *     *     * *:
1i1r_B_1     114:QEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVL: 168
SecStr          :HHHHHHH SS        HHHHHHHTT  TTHHHHHHHHHHHHHHHHHHHHHHHH:    
ExpBur          :bebbeeeeeeeeeeeeeeeebeeebeeeeeeebbbbbbbbbbbbeebbeebbebb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123