Protein Model on 4cni_D_1_K_1 (TEMPLATE: 4cni )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) D 1 (D) polymer(polypeptide(L)) [171 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b K 1 (D) non-polymer(SO4) SULFATE ION 45Q 46P 47L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4cni_D_1 identity=100.0%
queryA        42:PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQAR: 141
                :****************************************************************************************************:
4cni_D_1       1:PHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQAR: 100
SecStr          :       HHHHHHHHHHHHHHHHHHHHHHHHTSTTTT  TTTHHHHTT       GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHHHH SS HHHHH:    
ExpBur          :eeeeeeeeeeebbebbeebbebbeebeebbbeeeeebeeeebeebeeebebbebeeebbbeeeeeeeeebbeebbbbbbebebbbebbbeebeeeeeebe:    
Contact         :   bbb                                                                                              

queryA       142:AVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***********************************************************************:
4cni_D_1     101:AVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 171
SecStr          :HHHHHHHHHHHHHHHHH   TT     HHHHHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :bbbebbeebbeebeeebeeeeebeeeeeeeeeebbeebeebeeebbbbbbbbbbebbeebbebbbebbeeb:    


Input Residue Numbers for Focused Sites

ex) 2,15,123