Protein Model on 4j4l_C_1_A_1 (TEMPLATE: 4j4l )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) C 1 (C) polymer(polypeptide(L)) [155 aa] Interleukin-6 :IL6_HUMAN
2 b A 1 (A) polymer(polypeptide(L)) [258 aa] Internalin B,REPEAT MODULES,Variable lymphocyte receptor B :A4L9V2_LISMN:Q4G1L3_EPTBU 47L 48T 51E 52R 54D 55K 56Q 58R 59Y 138E 141R 145M 146S 148K 149V 152Q 153F 210R (identity: 100.0 %/91.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4j4l_C_1 identity=91.6%
queryA        46:PLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQM: 145
                : *********************************         *********************************************************:
4j4l_C_1       2:SLTSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQM: 101
SecStr          :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH    ---------        GGGT SSSS  HHHHHHHHHHHHHHHHHHHHTTTTS SSSHHHHHHHHH:    
ExpBur          :eeeeeeebbebbeebbebbebbbebbbeeeebee---------ebebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbebbeebeeebebbee:    
Contact         : bb  bb bbb bb                                                                              b  b   b

queryA       146:STKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***************    ************************************************:
4j4l_C_1     102:STKVLIQFLQKKAKNXXXXTTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 168
SecStr          :HHHHHHHHHHHH   ----    HHHHHHHHHHHHTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :bbeebbebbeeeeee----eeeeeeeeeeebeebeeeeeeebeebbbebbebbeebbebbbebbeee:    
Contact         :b bb  bb                                                        b                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123