Protein Model on 4ni7_A_1_B_1 (TEMPLATE: 4ni7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [151 aa] Interleukin-6 :IL6_HUMAN
2 b B 1 (B) polymer(polydeoxyribonucleotide) [31 base] SOMAmer SL1025 44R 47L 52R 55K 56Q 58R 59Y 61L 62D 145M 146S 149V 152Q 153F 156K 199K 203Q 206L 210R (identity: 100.0 %/89.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ni7_A_1 identity=89.3%
queryA        44:RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAV: 143
                :********************************             *******************************************************:
4ni7_A_1      18:RQPLTSSERIDKQIRYILDGISALRKETCNKSXXXXXXXXXXXXXNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAV: 117
SecStr          :     HHHHHHHHHHHHHHHHHHHHHHHHTT -------------        GGG  SSTT  HHHHHHHHHHHHHHHHHHHHHHTTS SSTHHHHHHH:    
ExpBur          :eeeeeeeeebeebbeebbebbeebbeebeeee-------------eeebbebeeebbbeeeeeeeeebbebbbbbbbebebbbebbbeebeeeeebbebb:    
Contact         :b  b    b  bb bb bb                                                                                 

queryA       144:QMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***************     *************************************************:
4ni7_A_1     118:QMSTKVLIQFLQKKAXXXXXITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHHHHH -----     HHHHHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :bebbeebbeebeeee-----eeeeeeeeeeeebeebeeeeeeebeebbeebbebbeebbeebbebbeeb:    
Contact         : bb  b  bb  b                                          b   b  b   b                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123