Protein Model on 4ni9_C_1_D_1 (TEMPLATE: 4ni9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) C 1 (C) polymer(polypeptide(L)) [148 aa] Interleukin-6 :IL6_HUMAN
2 b D 1 (D) polymer(polydeoxyribonucleotide) [32 base] SOMAmer SL1025 47L 52R 55K 56Q 58R 59Y 61L 62D 141R 145M 146S 149V 152Q 153F 156K 203Q 207R 210R (identity: 100.0 %/87.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4ni9_C_1 identity=87.6%
queryA        44:RQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAV: 143
                :****************************                ********************************************************:
4ni9_C_1      18:RQPLTSSERIDKQIRYILDGISALRKETXXXXXXXXXXXXXXXXNNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAV: 117
SecStr          :     HHHHHHHHHHHHHHHHHHHHHH ----------------  S      GGG  SSSS  HHHHHHHHHHHHHHHHHHHHTTGGGGTTSHHHHHHH:    
ExpBur          :eeeeeeebebbebbeebeebbeebbeee----------------eeeebbebeeebbbeeeeeeeeebbeebbbbbbebebbbebbeebbeeeeeebeeb:    
Contact         :   b    b  bb bb bb                                                                              b  

queryA       144:QMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***************     *************************************************:
4ni9_C_1     118:QMSTKVLIQFLQKKAXXXXXITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHHHH  -----     TTTHHHHHHHHTTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :bebbeebbeebeeee-----eeeeeeeeeeeeeeebeebeeeebeebbebbbeebeebbebbbebbeeb:    
Contact         : bb  b  bb  b                                              b   b  b                                 


Input Residue Numbers for Focused Sites

ex) 2,15,123