Protein Model on 4o9h_A_1_C_1 (TEMPLATE: 4o9h )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [152 aa] Interleukin-6 :IL6_HUMAN
2 b C 1 (L) polymer(polypeptide(L)) [211 aa] Light Chain of the Camelid Fab fragment 61H7 49S 50S 51E 54D 55K 58R 210R (identity: 100.0 %/91.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4o9h_A_1 identity=91.6%
queryA        47:LTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS: 146
                :******************************            ********************************************  ************:
4o9h_A_1      21:LTSSERIDKQIRYILDGISALRKETCNKSNXXXXXXXXXXXXNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRXXSSEEQARAVQMS: 120
SecStr          :   HHHHHHHHHHHHHHHHHHHHTTTTT  ------------        GGGS SSTT  HHHHHHHHHHHHHHHHHHHHHHHH --  HHHHHHHHHH:    
ExpBur          :eeeeeebeebbeebbeebebbeeebeeeee------------eeebbebeeebbbeeeeeeeeebbeebbbbbbebebbbebbeee--eeeeebeebbeb:    
Contact         :  bbb  bb  b                                                                                        

queryA       147:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :******************************************************************:
4o9h_A_1     121:TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 186
SecStr          :HHHHHHHHHHHTTT        HHHHHHHHHHHHTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :beebbebbeeebeeeeeeeeeeeeeeeeebeebeeeeeeebeebbeebbebbeebbebbbebbeee:    
Contact         :                                                               b                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123