Protein Model on 4zs7_A_1_C_1 (TEMPLATE: 4zs7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [139 aa] Interleukin-6 :IL6_HUMAN
2 b C 1 (L) polymer(polypeptide(L)) [210 aa] Llama Fab fragment 68F2 light chain 95M 97E 102F 103Q 104S 200E 203Q 204S 207R 210R 211Q (identity: 100.0 %/85.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4zs7_A_1 identity=85.8%
queryA        51:ERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL: 150
                :**************************              ************************************************************:
4zs7_A_1      10:ERIDKQIRYILDGISALRKETCNKSNXXXXXXXXXXXXXXNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL: 109
SecStr          : TTHHHHHHHHHHHHHHHHHHHHHH --------------      STT  SSSS  HHHHHHHHHHHHHHHHHHTTTSSSS STTHHHHHHHHHHHHHH:    
ExpBur          :eeeeebbeebbebbeebeeebeeebe--------------ebbebeeebbbeeeeeeeeebbbbbbbbbeebbebbebbbeeeeebeeebeebbebbeeb:    
Contact         :                                            b b    bbb                                              

queryA       151:IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :************     *************    ****************************:
4zs7_A_1     110:IQFLQKKAKNLDXXXXXDPTTNASLLTKLQXXXXWLQDMTTHLILRSFKEFLQSSLRALRQM: 171
SecStr          :HHHHHHHS S  ----- HHHHHHHHHH  ---- HHHHHHHHHHHHHHHHHHHHHHHHHH :    
ExpBur          :beebeeeeeeee-----eeeebeeebeeee----eeebebbeebbebbeebbeebbebbeee:    
Contact         :                                                 b  bb  b  bb                                       


Input Residue Numbers for Focused Sites

ex) 2,15,123