Protein Model on 5fuc_A_1_D_1 (TEMPLATE: 5fuc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [152 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b D 1 (D) polymer(polypeptide(L)) [198 aa] INTERLEUKIN-6 RECEPTOR SUBUNIT ALPHA, INTERLEUKIN-6 RECEPTOR :D6R9R8_HUMAN:IL6RA_HUMAN 58R 61L 101C 102F 103Q 104S 199K 200E 203Q 206L 207R 208A 210R 211Q (identity: 100.0 %/90.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fuc_A_1 identity=90.9%
queryA        48:TSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST: 147
                : *******************************           *********************************************************:
5fuc_A_1       2:SSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXXXNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST: 101
SecStr          : HHHHHHHHHHHHHHHHHHHHHHHHHTSS   -----------      GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHTT  STTHHHHHHHHHHH:    
ExpBur          :eeeeebeebbeebbebbeebbebbeeeeebbe-----------ebbebeeeebbeeeeeeeeebbebbbebbbebebbbebbbebbeebeeebeebbebb:    
Contact         :          b  b                                       bbbb                                           

queryA       148:KVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***********   ***************************************************:
5fuc_A_1     102:KVLIQFLQKKAXXXDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 166
SecStr          :HHHHHHHHTT ---       HHHHHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHHHHHHHHT :    
ExpBur          :eebbeebeeee---eeeeeeeeeeeeebeeebeeeeeeebeebbbebbebbeebbebbbebbeeb:    
Contact         :                                                   bb  b  bbb bb                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123