Protein Model on 5fuc_A_1_F_1 (TEMPLATE: 5fuc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) A 1 (A) polymer(polypeptide(L)) [152 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b F 1 (V) polymer(polypeptide(L)) [124 aa] VHH6 48T(S) 50S 51E 54D 103Q 106F 108E 210R 211Q 212M (identity: 90.0 %/90.9 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fuc_A_1 identity=90.9%
queryA        48:TSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST: 147
                : *******************************           *********************************************************:
5fuc_A_1       2:SSSERIDKQIRYILDGISALRKETCNKSNMCEXXXXXXXXXXXNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMST: 101
SecStr          : HHHHHHHHHHHHHHHHHHHHHHHHHTSS   -----------      GGGT SSTT  HHHHHHHHHHHHHHHHHHHHHHTT  STTHHHHHHHHHHH:    
ExpBur          :eeeeebeebbeebbebbeebbebbeeeeebbe-----------ebbebeeeebbeeeeeeeeebbebbbebbbebebbbebbbebbeebeeebeebbebb:    
Contact         :b bb  b                                                b  b b                                       

queryA       148:KVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***********   ***************************************************:
5fuc_A_1     102:KVLIQFLQKKAXXXDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 166
SecStr          :HHHHHHHHTT ---       HHHHHHHHHHHHHS HHHHHHHHHHHHHHHHHHHHHHHHHHHT :    
ExpBur          :eebbeebeeee---eeeeeeeeeeeeebeeebeeeeeeebeebbbebbebbeebbebbbebbeeb:    
Contact         :                                                              bbb                                   


Input Residue Numbers for Focused Sites

ex) 2,15,123