Protein Model on 5fuc_B_1_E_1 (TEMPLATE: 5fuc )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(IL6_HUMAN) B 1 (B) polymer(polypeptide(L)) [160 aa] INTERLEUKIN-6 :IL6_HUMAN
2 b E 1 (E) polymer(polypeptide(L)) [110 aa] VHH6 50S 51E 106F 108E 210R 211Q 212M (identity: 100.0 %/97.6 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5fuc_B_1 identity=97.6%
queryA        49:SSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK: 148
                :****************************************************************************************************:
5fuc_B_1       3:SSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK: 102
SecStr          : HHHHHHHHHHHHHHHHHHHHHHHHHSS  S  TTS  TTTT      GGGS SSTT  HHHHHHHHHHHHHHHHHHHHHHTT  SSSHHHHHHHHHHHH:    
ExpBur          :eeeebeebbeebbebbebbbebbeeebebeeeeeeebeeeeeebbebeeebbbeeeeeeeeebbebbbbbbbebbbbbebbbebbeebeeebebbbebbe:    
Contact         : bb                                                      b b                                        

queryA       149:VLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 212
                :***********    *************************************************:
5fuc_B_1     103:VLIQFLQKKAKXXXXITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM: 166
SecStr          :HHHHHHHHH  ----     HHHHHHHHHHHTTS HHHHHHHHHHHHHHHHHHHHHHHHHHTT :    
ExpBur          :ebbeebeeebe----eeeeeeeebeeebeebeeeeeeebbbbbbbbbbbbeebbebbbebbeee:    
Contact         :                                                             bbb                                    


Input Residue Numbers for Focused Sites

ex) 2,15,123