#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3d23_D_2_A_1

Protein Model on 3d23_D_2_A_1 (TEMPLATE: 3d23 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 2 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1
2 b A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1 3264S 3265G 3267R(V) 3268K 3269M 3270A(V) 3272P 3273S(T) 3274G(S) 3277E 3384S(R) 3386S(Q) 3387G 3388V(A) 3389Y(F) 3400K 3401G 3402S 3404L 3432T 3433G 3434V(C) 3478G(N) 3543T(Q) 3548A(C) 3549L(T) 3561R(Q) 3562Q 3563C(L) (identity: 48.3 %/49.5 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_D_2 identity=49.5%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_D_2       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          :-         TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHGGG  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :-eeeeeeeeeeebeebbbbbbbeeeebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebebeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         :bb bbbb bbb  b                                                                                      

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_D_2     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B :    
ExpBur          :eeebebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                    b bbbb          bbb b                           bbb                             

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_D_2     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHTT-  TT  SSS SS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeee--beebbeeeebebebbbbbbeebee-ebeeeebeeeeebebebbbebbeeee:    
Contact         :              b                                                                b    bb           bbb

queryA      3564:SG:3565
                : *:
3d23_D_2     300:AG: 301
SecStr          :T :    
ExpBur          :ee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123