#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 3iwm_D_2_G_1

Protein Model on 3iwm_D_2_G_1 (TEMPLATE: 3iwm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 2 (D) polymer(polypeptide(L)) [300 aa] 3C-like proteinase :R1A_CVHSA
2 b G 1 (G) polymer(polypeptide(L)) [6 aa] N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-N~1~-((1R,2Z)-4-(BENZYLOXY)-4-OXO-1-{[(3R)-2-OXOPYRROLIDIN-3-YL]METHYL}BUT-2-ENYL)-L-LEUCINAMIDE 3264S (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3iwm_D_2 identity=96.0%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :********************************** ********** ****************** ******************** * ***** ******:
3iwm_D_2       1:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK: 100
SecStr          :          HHHHTTEEB EETTEE  EE  TT  B BTTTT  STTSSS   TT  SSSTTTS   EETTEE  B   B  TTB B  BSS  TT   :    
ExpBur          :eeeeeeeeebeebeebbbbbbbeeeebbbbbbeebbbbbbebbbeeeeeeebebeeeeeebeeeebebbbeeeebebebeeeeebbbebebeeebeebbe:    
Contact         :b                                                                                                   

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :********************************* ********************************************* ********************:
3iwm_D_2     101:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTI: 200
SecStr          :B      TT B EEEEESSS EEEEE  B  TTS B     TT TT EEE  STTSB   EEEEE  SSS BEEE SSS BSSS  SS S          :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeeebebbebebbeeebeeebbbbbbbebeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeebeeeeeb:    

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :* **************************************************************** *****************  **************:
3iwm_D_2     201:TLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 300
SecStr          :HHHHHHHHHHHHHTT    SSTT   HHHHHHHHTTSS     HHHHHHHHHHHHHHT  HHHHHHHHHHHHHH  SS  BTTBSS   S  HHHHHHT :    
ExpBur          :eeeeeeeeebbeeeeeeeeeeeeebeeeebeebbeeeeeeebeeeebeeeeebeeeeeeebeeebbeebeebeeebeeeeeeeeeeeeeeeeeeeeeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123