#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 4wmd_C_1_C_2

Protein Model on 4wmd_C_1_C_2 (TEMPLATE: 4wmd )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [303 aa] ORF1a :W6A941_9BETC
2 b C 2 (C) polymer(polypeptide(L)) [303 aa] ORF1a :W6A941_9BETC 3264S 3265G 3267R(V) 3268K 3269M 3270A(S) 3271F(H) 3272P 3273S 3274G 3277E 3385P 3386S(T) 3387G 3388V(T) 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3429E 3432T(N) 3433G 3435H 3477N 3546G 3547S 3548A(T) 3549L(M) 3561R(M) 3562Q 3563C(I) 3565G (identity: 67.6 %/51.8 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:4wmd_C_1 identity=51.8%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQ---AGNVQLRVIGHSMQNCVLKLKVDTANPK:3360
                :**  **  *** ** ********  ********  * ***** *       ***  ***   ** * **        *** ** **   *** ** *** :
4wmd_C_1       1:SGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPS: 100
SecStr          :          HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGGS TTTTTS  HHHHHHT  GGGEEEE  SSS  EE EEEEEEETTEEEEEESS  TT:    
ExpBur          :eebeeeeeebeebeebbbbbebeebebbbbbbeebbbbbbbbbbeeeebeebebeebeeebeeeebebebeeeeeeebebebeeeeebbbebebeeebee:    
Contact         :bb bbbbbbbb  b                                                                                      

queryA      3361:TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTD:3460
                :** * *    **  ********* * *     **** ******* ** ****         ***** ***  * * *    *  ** * * *  *   **:
4wmd_C_1     101:TPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSAGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTD: 200
SecStr          :  SEE     TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEEEETTEEEEE TTS BGGG  SSSS       :    
ExpBur          :ebeeeeeebeebeebbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbeeeeeebbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeee:    
Contact         :                        bbbbb          bbbbb                        b  bb b                         

queryA      3461:TTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNY-EPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDV:3559
                :    *** ******  **  **     *    **  *      *      **    *   ** *          *   *  *  ****  ******* **:
4wmd_C_1     201:KYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDM---LAVKTGVAIEQLLYAIQQLY-TGFQGKQILGSTMLEDEFTPEDV: 296
SecStr          : B HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHTTTB      HHHHH---HHHHHT  HHHHHHHHHHHH-H  TT  BTTBSS      HHHH:    
ExpBur          :eebbebbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebeebeeeebbee---bbeebebbbebbbebbbebe-eebeeeebeebeebebbbbbebb:    
Contact         :                b                                                                     bbbb          

queryA      3560:VRQCSGV:3566
                :  *  **:
4wmd_C_1     297:NMQIMGV: 303
SecStr          :HHHHH  :    
ExpBur          :bebeeee:    
Contact         : bbb b                                                                                              


Input Residue Numbers for Focused Sites

ex) 2,15,123