#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 5tl7_D_1_C_1

Protein Model on 5tl7_D_1_C_1 (TEMPLATE: 5tl7 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) D 1 (D) polymer(polypeptide(L)) [313 aa] Replicase polyprotein 1ab :R1AB_CVHSA
2 b C 1 (C) polymer(polypeptide(L)) [77 aa] Ubiquitin-like protein ISG15 :ISG15_MOUSE 1669W 1672N 1674C 1675Y 1719N 1720K 1724E 1725L 1726G 1727D 1729R 1730E 1733S(T) 1734Y(H) 1737Q 1766E 1827Y 1831Y 1832Q 1833C 1834G 1835H 1836Y 1864T (identity: 91.7 %/82.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:5tl7_D_1 identity=82.7%
queryA      1566:RTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLT:1665
                : ********** ***** ***************************  ****** *** ***** ******** * ***************** *** ***:
5tl7_D_1       7:KTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLT: 106
SecStr          : EEEEEEESSSS  EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE    SHHHHHHHHHH    TTHHHHHHHHHHHHTTS   EETTEE:    
ExpBur          :eebebebbeebeeeeeeebebeebbeeeeeebbbebeebbeeebeeebeeeebbbeeeeeeeeeebeeebebeeebbbbbbebbbbebeebebeebeebb:    

queryA      1666:SIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGV:1765
                :***********   ** *** * *** **** ******** *********** **************  * ***** * ********* ***  *** **:
5tl7_D_1     107:SIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGV: 206
SecStr          :   S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHHT  HHHHHHHHHHHT  TT    HHHHHHHHGGGBS TT EEEEEEEETTTEEEEEEEETH:    
ExpBur          :bbeeeeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbebbebeebebbbbbebeeeeeeeeebeeb:    
Contact         :   b  b bb                                           bb   bbbb bb  bb  b                            

queryA      1766:EAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITD:1865
                :***********   * ** *** **  ** ******* ********* * *  *** ** *********** *** ***** **** *** ****** **:
5tl7_D_1     207:EAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD: 306
SecStr          :HHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEE TTS SEEEEEEE SSSEEEEEEEESSSEEEEETTEEEEES EEEEEEE:    
ExpBur          :ebbbbeebbbbeebbebbeeebeeeeebebbbeebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebbbbbeeebbbebebeeeeeeeebebebbb:    
Contact         :b                                                            b   bbbbbb                           b 

queryA      1866:VFYKENSYTTTIK:1878
                :***** *******:
5tl7_D_1     307:VFYKETSYTTTIK: 319
SecStr          :EEEE SEEE    :    
ExpBur          :bbbebeebebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123