#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6vxs_B_1_I_1

Protein Model on 6vxs_B_1_I_1 (TEMPLATE: 6vxs )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [167 aa] Non-structural protein 3 :R1AB_SARS2
2 b I 1 (B) non-polymer(SO4) SULFATE ION 1176A 1177V 1178F 1179D 1182L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6vxs_B_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6vxs_B_1       3:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 102
SecStr          :     S EE SSSEEEEES HHHHHHHH  SEEEEEE TT    SHHHHHHHHHTTTHHHHHHHHHHHHH S  TT EEEEE TTT SEEEEEE   GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbebeeebebeeeebeebbebbeeebbeebeeebeeeeebeebbebebebeebbeebbbbbbbbeee:    

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL:1191
                :*******************************************************************:
6vxs_B_1     103:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL: 169
SecStr          :T  TTHHHHHHHGGGGSSEEEE  SS GGG   HHHHHHHHHHH  SEEEEEE  HHHHHHHHTT  :    
ExpBur          :eeeeeebeebbebbbebebbbbbbbbeeebebeeeebbebbeebbebebbbbbeeeeebeebeeeee:    
Contact         :                                                   bbbb  b                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123