#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wcf_A_1_C_1

Protein Model on 6wcf_A_1_C_1 (TEMPLATE: 6wcf )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [166 aa] Non-structural protein 3 :R1AB_SARS2
2 b C 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 1068G 1069G 1073G 1074A 1077K (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wcf_A_1 identity=100.0%
queryA      1026:NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG:1125
                :****************************************************************************************************:
6wcf_A_1       4:NSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKG: 103
SecStr          :    S EE SSSEEEESS HHHHHHHH  SEEEEE  TT    SHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEE    GGGT:    
ExpBur          :eebeebeebeebbbbbebebbebbeebebebbbbebeeebebeeeebbebbebbeeebbeebeebeeeeeebebbbebeeebeebbeebbbbbbbbeeee:    
Contact         :                                          bb   bb  b                                                

queryA      1126:EDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL:1191
                :******************************************************************:
6wcf_A_1     104:EDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL: 169
SecStr          :  TTHHHHHHHGGGGSSEEEE  SS STT   HHHHHHHHHHH  SEEEEE   HHHHHHHHHHH :    
ExpBur          :eeeeebeebbebbeebeebbbbbbbeeebebebeebbebbbebbebebbbbbeeeebbeebeeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123