#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6wen_A_1_B_1

Protein Model on 6wen_A_1_B_1 (TEMPLATE: 6wen )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [168 aa] Non-structural protein 3 :R1AB_SARS2
2 b B 1 (A) non-polymer(CL) CHLORIDE ION 1031Y 1032L 1033K (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6wen_A_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6wen_A_1       3:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 102
SecStr          :     S EE SSSEEEESS HHHHHHHH  SEEEEE  TT   SSHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEE    GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbbbeeebebeeeebbebbebbeeebbeebeeebeeeeebeebbebebebeebbeebbbbbbbbeee:    
Contact         :      bbb                                                                                           

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE:1192
                :********************************************************************:
6wen_A_1     103:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLE: 170
SecStr          :T  TTHHHHHHHGGGGSSEEEE  TT GGG   HHHHHHHHHHH  SEEEEE   HHHHHHHHHHHT :    
ExpBur          :eeeeeebeebbebbeebebbbbbbbbeeebebeebebbebbbebbebebbbbbeeeeebeebbebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123