#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xa9_A_1_I_1

Protein Model on 6xa9_A_1_I_1 (TEMPLATE: 6xa9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [313 aa] Papain-like protease :R1AB_SARS2
2 b I 1 (A) non-polymer(GOL) GLYCEROL 1580H 1582Q 1624D 1626T 1627L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xa9_A_1 identity=100.0%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
6xa9_A_1       5:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 104
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebebbbbeeeeeeeebebeebbeeebeebbbebeebbeeebeeebeeeebbbeeeeeebbebbeebbeeeeeebbbebbebbeebeebebeebeeb:    
Contact         :               b b                                         b bb                                     

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :****************************************************************************************************:
6xa9_A_1     105:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 204
SecStr          :E   S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEET:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbeebebeebbbbbbeebeeeeeeeeeeeb:    

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
6xa9_A_1     205:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 304
SecStr          :HHHHEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESEEEEEEE:    
ExpBur          :bebbbbeebbbbeebbebbeeeeeeeeebeebbbebebebbbbbbeeeeeebeeeebebbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebb:    

queryA      1865:DVFYKENSYTTTI:1877
                :*************:
6xa9_A_1     305:DVFYKENSYTTTI: 317
SecStr          :EEEEE SEEE   :    
ExpBur          :bbbbebeeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123