#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xa9_C_1_K_1

Protein Model on 6xa9_C_1_K_1 (TEMPLATE: 6xa9 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [313 aa] Papain-like protease :R1AB_SARS2
2 b K 1 (C) non-polymer(GOL) GLYCEROL 1636H 1691N 1692P 1737Q 1738H (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xa9_C_1 identity=100.0%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
6xa9_C_1       5:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 104
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TT    GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebbbbbbeeeeeeeebbbeeebeeebeebbeebeebbeebbeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeeb:    
Contact         :                                                                       b                            

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :****************************************************************************************************:
6xa9_C_1     105:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 204
SecStr          :E   S TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHHT  TT    HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEEG:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbebebeeeeebeebbeebbeebebeebbbbbbeebeeeeeeeeeeeb:    
Contact         :                          bb                                            bb                          

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
6xa9_C_1     205:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 304
SecStr          :GGGTEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEE  TTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESS EEEEE:    
ExpBur          :eebbbbeebbebeebbeebebeeeeeeebeeebbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeeebbbbebeeeeeeeebebebb:    

queryA      1865:DVFYKENSYTTTI:1877
                :*************:
6xa9_C_1     305:DVFYKENSYTTTI: 317
SecStr          :EEEEE SEEE   :    
ExpBur          :bbbbeeeeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123