#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xbg_B_1_H_1

Protein Model on 6xbg_B_1_H_1 (TEMPLATE: 6xbg )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [303 aa] main protease :R1AB_SARS2
2 b H 1 (B) non-polymer(NA) SODIUM ION 3534L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xbg_B_1 identity=100.0%
queryA      3266:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK:3365
                :****************************************************************************************************:
6xbg_B_1       5:FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYK: 104
SecStr          :        HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGG SS  HHHHHHT  GGG EEEETTEEE EEEEEEETTEEEEEESS  TT  EEE:    
ExpBur          :eeeeebebeebebbbbbbbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeebbeeeeeeebebbeeeeebebeeeeeeebbbebebeeebeeebeee:    

queryA      3366:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV:3465
                :****************************************************************************************************:
6xbg_B_1     105:FVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITV: 204
SecStr          :E    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B HH:    
ExpBur          :eeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeeebebbb:    

queryA      3466:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG:3565
                :****************************************************************************************************:
6xbg_B_1     205:NVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSG: 304
SecStr          :HHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHHHS :    
ExpBur          :bbbbbbbbbbeeeeeebeeeeebeeeebbebbeeeebeebeeebbeebeebbeebeeebeebbbbbeebbeeebeeeebeeeeeeebbbbbebbebeeee:    
Contact         :                                                                    b                               

queryA      3566:VTF:3568
                :***:
6xbg_B_1     305:VTF: 307
SecStr          :   :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123