#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6xg3_A_2_A_1

Protein Model on 6xg3_A_2_A_1 (TEMPLATE: 6xg3 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 2 (A) polymer(polypeptide(L)) [313 aa] Peptidase C16 :R1AB_SARS2
2 b A 1 (A) polymer(polypeptide(L)) [313 aa] Peptidase C16 :R1AB_SARS2 1622P 1623N 1625D 1628R 1629V 1632F 1637T 1638T 1639D 1640P 1641S 1717Y 1719N 1720K 1725L 1727D 1729R 1730E 1734Y 1737Q 1771M 1810P 1811P 1831Y (identity: 100.0 %/99.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6xg3_A_2 identity=99.7%
queryA      1565:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL:1664
                :****************************************************************************************************:
6xg3_A_2       5:VRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGL: 104
SecStr          :  EEEEEEESSSSS EEEEEETTS HHHHHSSEEETTEE TTS   GGGTT EEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTE:    
ExpBur          :eeebebbbbbbeeeeeeeebebeebbeeebeebbeebeebbeeebeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeeb:    
Contact         :                                                         bb b  bb  b    bbbbb                       

queryA      1665:TSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG:1764
                :********* ******************************************************************************************:
6xg3_A_2     105:TSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKG: 204
SecStr          :E     TT HHHHHHHHHHTTS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TTS   HHHHHHHHHHTB  TT EEEEEEEETTTEEEEEEEEG:    
ExpBur          :bbbeeeeebbbbbbbbbbbbbbebebebebbeebbeebeeeebbbbbbbbbbbbeeebeeebebeebbbebbeebebeebebbbbbebeeeeeeeeeeeb:    
Contact         :                                                    b bb    b b bb   b  b                           

queryA      1765:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT:1864
                :****************************************************************************************************:
6xg3_A_2     205:VEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPIT: 304
SecStr          :GGGTEEES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEEEETTEEEEEEEEESSSEEEEETTEEEEESEEEEEEE:    
ExpBur          :bebbbbeebbbbeebbebbeeebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeeeebebbbbeebbbbbebeeeeeeeebebebb:    
Contact         :      b                                      bb                   b                                 

queryA      1865:DVFYKENSYTTTI:1877
                :*************:
6xg3_A_2     305:DVFYKENSYTTTI: 317
SecStr          :EEEEE SEEE   :    
ExpBur          :bbbbebeeeebee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123