#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6ywm_C_1_P_1

Protein Model on 6ywm_C_1_P_1 (TEMPLATE: 6ywm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:3]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) C 1 (C) polymer(polypeptide(L)) [169 aa] NSP3 macrodomain :R1AB_SARS2
2 b P 1 (C) non-polymer(EDO) 1,2-ETHANEDIOL 1179D 1181N 1182L (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6ywm_C_1 identity=100.0%
queryA      1025:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK:1124
                :****************************************************************************************************:
6ywm_C_1       4:VNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNK: 103
SecStr          : S   S EE SSSEEEEES HHHHHHHH  SEEEEEE TT    SHHHHHHHHHTTTHHHHHHHHHHHHH    TT EEEEE TTT SEEEEEE   GGG:    
ExpBur          :eeebeebeebeebbbbbebebbebbeebebebbbbebeeebebeeeebeebbebbeeebbeebeeeeeeeeebeebeebebebeebbeebbbbbbbbeee:    

queryA      1125:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL:1191
                :*******************************************************************:
6ywm_C_1     104:GEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFL: 170
SecStr          :T  TTHHHHHHHGGGGSSEEEE  TT STT   HHHHHHHHHHH  SEEEEEE  HHHHHHHHHHH :    
ExpBur          :eeeeeebeebbebbbeeeebbbbbbbeeebebeeeebbebbbebbebebbbbbeeeeebeebbeeee:    
Contact         :                                                      b bb                                          


Input Residue Numbers for Focused Sites

ex) 2,15,123