#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 6yyt_B_1_C_1

Protein Model on 6yyt_B_1_C_1 (TEMPLATE: 6yyt )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) B 1 (B) polymer(polypeptide(L)) [186 aa] nsp8 :R1AB_SARS2
2 b C 1 (C) polymer(polypeptide(L)) [73 aa] nsp7 :R1AB_SARS2 4104A 4105D 4121N (identity: 100.0 %/100.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:6yyt_B_1 identity=100.0%
queryA      3948:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN:4047
                :****************************************************************************************************:
6yyt_B_1       9:FSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNN: 108
SecStr          : TTSHHHHHHHHHHHHHHHHHHHT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS HHHHHH:    
ExpBur          :eeebebbeebeebeeebeebeeeeeeeeeeeeeeeeeeebeeeeeebbeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeee:    

queryA      4048:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA:4133
                :**************************************************************************************:
6yyt_B_1     109:IINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRA: 194
SecStr          :HHHH SSS   STHHHHHH SEEEEEE SHHHHHHSS SSEEEETTEEEEEEEEE TTS B  TTT  STTTTTS SSEEEEEEE :    
ExpBur          :beeeeeeeeeeeeeeeeebeeebeeebeebeebeeebeeeebeeeebebebeebbbeeeeebeeeebeeeebeebeeebebbbeee:    
Contact         :                                                        bb               b                          


Input Residue Numbers for Focused Sites

ex) 2,15,123