#WARNING:no index is registered index 'YP_009725295.1' in 'http://www.uniprot.org/uniprot/' Protein Model on 7jiw_A_1_K_1

Protein Model on 7jiw_A_1_K_1 (TEMPLATE: 7jiw )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model] [for PyMOL]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(queryA) A 1 (A) polymer(polypeptide(L)) [305 aa] Papain-Like Protease :R1A_SARS2
2 b K 1 (A) non-polymer(MES) 2-(N-MORPHOLINO)-ETHANESULFONIC ACID 1668K 1669W 1849D 1850G 1851A 1852L (identity: 100.0 %/98.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:7jiw_A_1 identity=98.7%
queryA      1570:VFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKW:1669
                :**************    **********************************************************************************:
7jiw_A_1      10:VFTTVDNINLHTQVXXXXMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKW: 109
SecStr          : EEESSSSS EE  ----  HHHHHSSEEETTEE SSS   SSSSSSEEEE   SHHHHHHHHHHHS   TTHHHHHHHHHHHHTTS   EETTEE   S:    
ExpBur          :bebbbbeeeeeeee----ebbeeebeebbbebeebbeeeeeeebeeeebbbeeeeeebeebbeebbeeeeeebbbebbebbeebeebebeebeebbbbee:    
Contact         :                                                                                                  bb

queryA      1670:ADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVM:1769
                :****************************************************************************************************:
7jiw_A_1     110:ADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVM: 209
SecStr          : TTTHHHHHHHHHHTSS   BSSHHHHHHHHHHHTT  HHHHHHHHHHTT  TT    HHHHHHHHHTTB  TT EEEEEEEETTTEEEEEEEETHHHHE:    
ExpBur          :eeebbbbbbbbbbbbbbebebebebbbebbeebeeeebbebbbbbbbbbebeeeeebebeebbeebbeebebeebebbbbeebeeeeeeeeeeebbebbb:    

queryA      1770:YMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYK:1869
                :****************************************************************************************************:
7jiw_A_1     210:YMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYK: 309
SecStr          :EES S HHHHHH EEEE TTSSEEEEEEEEEESSEEEEEEEEEEEEEETTS SEEEEEESSTTTSEEEEEEESSSEEEEETTEEEEESEEEEEEEEEEEE:    
ExpBur          :beebbbbeebbebbeeebeeeeebeebbbebebebbbbbbeeeeeebeeeebbbbbbbeeeeeebebebbbbeebbbbbebeeeeeeeebebebbbbbbe:    
Contact         :                                                                               bbbb                 

queryA      1870:ENSYTTTIK:1878
                :*********:
7jiw_A_1     310:ENSYTTTIK: 318
SecStr          : SEEE S  :    
ExpBur          :beeeebeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123