Protein Model on 1p9u_B_1_P_1 (TEMPLATE: 1p9u )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) B 1 (B) polymer(polypeptide(L)) [300 aa] putative coronavirus nsp2 (3CL-PRO) :R1AB_CVPPU
2 b P 1 (B) non-polymer(SO4) SULFATE ION 3298V(E) 3300Y(I) 3346Q(K) 3366F 3440L(F) (identity: 20.0 %/45.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:1p9u_B_1 identity=45.2%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :** **** *** ** * * *  *   ****** * * ******         ***        *** *   ** * *         * ***   ** ** :
1p9u_B_1       1:SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRV-INYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPE:  99
SecStr          :          TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG S TTS -  HHHHHHT  GGGEEEESSS EE EEEEEEETTEEEEEESS  TT   :    
ExpBur          :eebeeeeeebeebeebbbebbbeebebbbbbbeeebbbbbbbbbeeeeee-bebeebbeebeeeebebbbeeeebebeeeeeeebbbbbebeeebeeebe:    
Contact         :                                  b b                                             b                 

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                : **  *  *  *  **** * *  **   **   ******  * *****         * **** **  * * *   **  **   *    *  **    :
1p9u_B_1     100:HKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMS: 199
SecStr          : EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BGGG  SSSS        B :    
ExpBur          :eeeeebeebeebbbbbbeebeeeeeebbbbbeebbbeeebeebbbbbbbbbeeeeebbbbbbbbbebeeebbbbbbbebebbeebebbeeeeebeebeeb:    
Contact         :  b                                                                         b                       

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :  ** * **** *** ***       *   *  *       *     *    * * **  *     *    *  *  *****    * *****  * ** :
1p9u_B_1     200:SDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSS--TDAFSMLAAKTGQSVEKLLDSIVR-LNKGFGGRTILSYGSLCDEFTPTEVIRQM: 296
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB     --SGGGHHHHHHHS  HHHHHHHHHH-HTT  TT  BTTBSS      HHHHHTTT:    
ExpBur          :bebbbbbbbbbbeeeeeebbeeeebebeebbebbeeeebeebee--eeebeebeeeeebebeebbbbbbe-beeebeeeebbeeeebbbebbbebbbeeb:    

queryA      3564:SGV:3566
                : **:
1p9u_B_1     297:YGV: 299
SecStr          :S  :    
ExpBur          :eee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123