Protein Model on 2ahm_F_1_L_1 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) F 1 (F) polymer(polypeptide(L)) [143 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b L 1 (F) non-polymer(GOL) GLYCEROL 4011Q (identity: 100.0 %/97.2 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_F_1 identity=97.2%
queryA      3992:DRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTY:4091
                :********************************************************************************** *** ******** ****:
2ahm_F_1      55:DRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTY: 154
SecStr          :  SHHHHHHHHHHHHHHHHTT   S  S SHHHHHHHHHHHHHHHHHHH  HHHHHHHHHHHTT  BSS    STT EEEEEE SHHHHHHHEETTEEEE:    
ExpBur          :eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeebeeeeeebeeeebebebbbeeeebbeebbeeeebeb:    
Contact         :                   b                                                                                

queryA      4092:ASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :*********************** *******************:
2ahm_F_1     155:ASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :TTEEEEEEEEE TTS B  GGG STTTGGGS SSEEEEEEEE :    
ExpBur          :bebebebeebbbeeeeebeeeebeeeebeebeeebebbbeebe:    


Input Residue Numbers for Focused Sites

ex) 2,15,123