Protein Model on 2ahm_H_2_E_2 (TEMPLATE: 2ahm )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) H 2 (H) polymer(polypeptide(L)) [191 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA
2 b E 2 (E) polymer(polypeptide(L)) [155 aa] Replicase polyprotein 1ab, heavy chain :R1AB_CVHSA 4066T 4067A 4097E 4099Q 4131L 4133A 4134N (identity: 100.0 %/97.4 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2ahm_H_2 identity=97.4%
queryA      3944:IASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND:4043
                :************* **************************************************************************************:
2ahm_H_2       7:IASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDND: 106
SecStr          :   S TTSHHHHHHHHHHHHHHHHHHTT  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH  H:    
ExpBur          :eeeeeeebebeeeeeebeeeeeebeeeeeeeeebeeeeeebeebeeebeeebeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeebeeeeee:    

queryA      4044:ALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRAN:4134
                :****************************** *** ******** *************************** *******************:
2ahm_H_2     107:ALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRAN: 197
SecStr          :HHHHHHHHHHTT EESS    STT EEEEEE SHHHHHHHEETTEEEETTEEEEEEEEE TTS B  GGG SGGGSTTS SSEEEEEEE  :    
ExpBur          :eeeeebebeeeebeeeeeebeeeebebebbbeebebbeebbeeeebebbebebebeebbbeeeeebeeeebeeeebeebeeebebbbeebe:    
Contact         :                      bb                             b b                               b bb         


Input Residue Numbers for Focused Sites

ex) 2,15,123