Protein Model on 2gtb_A_2_C_2 (TEMPLATE: 2gtb )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 2 (A) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHSA
2 b C 2 (A) non-polymer(ACY) ACETIC ACID 3268K 3270A 3388V 3389Y 3390Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2gtb_A_2 identity=96.0%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY:3364
                :********************************* ********** ****************** ******************** * ***** *******:
2gtb_A_2       3:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 102
SecStr          :         HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  GGGSSS  HHHHHHT  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :ebeeeebebeebeebbbbbbbeeeebbbbbbeebbbbbbbbbbeeeeeeebebeeebeebeeeebebeeeeeebebebeeebebbbebebeeebeeebee:    
Contact         :   b b                                                                                              

queryA      3365:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT:3464
                :******************************** ********************************************* *********************:
2gtb_A_2     103:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 202
SecStr          :EE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SSSS        B H:    
ExpBur          :eeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeeeeeeeeeebb:    
Contact         :                       bbb                                                                          

queryA      3465:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                : **************************************************************** *****************  **************:
2gtb_A_2     203:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC: 301
SecStr          :HHHHHHHHHHHHHT  TT  SS   HHHHHHHHHTTTB    HHHHHHTHHHHHHHT  HHHHHHHHHHHHHT  SS  BTTBSS   S  HHHHHHH :    
ExpBur          :bbbbbbbbbbbeeeeeebeeeeebeeeebbeebeeeebeebeeeebeebeebeeebebebeebbbbbbbbbeebbeeeebeeeeebbbbbbbebbeeee:    


Input Residue Numbers for Focused Sites

ex) 2,15,123