Protein Model on 2vj1_A_1_C_1 (TEMPLATE: 2vj1 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (A) polymer(polypeptide(L)) [300 aa] SARS CORONAVIRUS MAIN PROTEINASE :A7J8L3_CVHSA
2 b C 1 (A) non-polymer(DMS) DIMETHYL SULFOXIDE 3519Q (identity: 100.0 %/96.0 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:2vj1_A_1 identity=96.0%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY:3364
                :********************************* ********** ****************** ******************** * ***** *******:
2vj1_A_1       1:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKY: 100
SecStr          :  S      HHHHTTEEEEEETTEEEEEEEETTEEEEEGGGG  HHHHHS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  EE:    
ExpBur          :beeeeebebeebeebbbebbbeeeebbbbbbeebbbbbbbbbbeeeebeebebeeebeebeeeebebebeeeebebeeeeeeebbbebebeeebeeebee:    

queryA      3365:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT:3464
                :******************************** ********************************************* *********************:
2vj1_A_1     101:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTIT: 200
SecStr          :EE    TT EEEEEEEETTEEEEEEEEEB TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSSS  SS S        B H:    
ExpBur          :eeeebeebebbbbbbbeebeeeeeebbbbbbbebbeeebeeebbbbbbbbbeeebbbbbbbbbbebeeebbbbbbbebebbeebebeeeebeeeebbebb:    

queryA      3465:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS:3564
                : **************************************************************** *****************  ***************:
2vj1_A_1     201:LNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS: 300
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHTTB    HHHHHHTHHHHHHH   HHHHHHHHHHHHHH  TT  BTTBSS   S  HHHHHHTT :    
ExpBur          :bbbbbbbbbbbeeeeeebeeeeebebeebbebbeeeebeebeeeebeebeebbeeeebebeebbbbbbebbeeebeeeebbebeebbbbbbbebbeeeee:    
Contact         :                                                      b                                             


Input Residue Numbers for Focused Sites

ex) 2,15,123