Protein Model on 3d23_A_1_D_2 (TEMPLATE: 3d23 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:2]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) A 1 (B) polymer(polypeptide(L)) [301 aa] 3C-like proteinase :R1AB_CVHN1
2 b D 2 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 3265G 3267R(V) 3268K 3269M 3270A(V) 3272P 3273S(T) 3274G(S) 3277E 3386S(Q) 3387G 3388V(A) 3389Y(F) 3400K 3401G 3402S 3403F 3404L 3417Y(G) 3429E 3432T 3433G 3435H 3543T(Q) 3548A(C) 3549L(T) 3562Q 3563C(L) 3565G (identity: 58.6 %/49.7 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_A_1 identity=49.7%
queryA      3264:SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPK:3363
                :**  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ***:
3d23_A_1       3:SGIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPK: 102
SecStr          : S        TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  SSSTTS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  S:    
ExpBur          :eebeeeeeeeeebeebbbbbebeebebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebeeeeeebebeeeeeeebbbbbbbeeebeeebe:    
Contact         : b bbbb bbb  b                                                                                      

queryA      3364:YKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTI:3463
                :* *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   :
3d23_A_1     103:YTFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQ: 202
SecStr          :EEE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEE  TT EEEEEEEEEEEETTEEEEE TTS BSTT  SSSS        B :    
ExpBur          :eeeeebeebebbbbbbbbebeeeeeebbbbbbbebbeeebeeebbbbbbbebeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeeb:    
Contact         :                      bbbb          bbbbb            b           b  bb b                            

queryA      3464:TVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQC:3563
                :**** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  * :
3d23_A_1     203:TVNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQL: 299
SecStr          :HHHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHHT-  TT  BTTBSS   SS HHHHHHHH:    
ExpBur          :bbbbbbbbbbbbeeebeebeeeeebeeeebbebbeeeebbebeeeee--beebbeebebebebbbbbbeebee-ebeeeebeebeebebebbbebbeeee:    
Contact         :                                                                               b    bb            bb

queryA      3564:SGV:3566
                : **:
3d23_A_1     300:AGV: 302
SecStr          :H  :    
ExpBur          :eee:    
Contact         : b                                                                                                  


Input Residue Numbers for Focused Sites

ex) 2,15,123