Protein Model on 3d23_C_1_D_1 (TEMPLATE: 3d23 )

CurrentView:HTML5 Change to:[JAVA (faster than HTML5)] DOWNLOAD:
[sequence-replaced 3D model]
[3D template]
[Modeller script]

ALL MOLECULES IN THE BIOLOGICAL UNIT:
[assembly_id:1]

Window size :
[small] [medium] [large]

[help]


MOLECULES contact sites
model mark query asym_id oper
(auth_asym_id)
type description a(query A)
1 a A(R1A_SARS2) C 1 (C) polymer(polypeptide(L)) [298 aa] 3C-like proteinase :R1AB_CVHN1
2 b D 1 (D) polymer(polypeptide(L)) [299 aa] 3C-like proteinase :R1AB_CVHN1 3487T(V) (identity: 0.0 %/49.3 %)
ALIGNMENTS
MODEL[1] Protein A "queryA" TEMPLATE:3d23_C_1 identity=49.3%
queryA      3265:GFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKY:3364
                :*  **  *  * * * * ** *  ********* ********* *  *  * *  ** *     *    *   * *    ** * * * *   ** ****:
3d23_C_1       4:GIVKMVSPTSKIEPCIVSVTYGSMTLNGLWLDDKVYCPRHVICSSSNMNEPDYSALLCRVTLGDFTIMSGRMSLTVVSYQMQGCQLVLTVSLQNPYTPKY: 103
SecStr          :         TTTGGGEEEEEETTEEEEEEEETTEEEEEGGGG  TTTSSS  HHHHHHH  GGGEEEEETTEEE EEEEEEETTEEEEEESS  TT  SE:    
ExpBur          :eeeeeeeeeeebeebbbbbbbeebebbbbbbeeebbbbbbbbbeeeeeeebebeebeeebeeeebebeeeeeebebeeeeeeebbbbbbbeeebeeebee:    

queryA      3365:KFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTIT:3464
                : *    ** ** *** *** * *     **   ******* *******     * * * ***  ** ** * ***  ******  * *  *    *   *:
3d23_C_1     104:TFGNVKPGETFTVLAAYNGRPQGAFHVTMRSSYTIKGSFLCGSCGSVGYVLTGDSVKFVYMHQLELSTGCHTGTDFTGNFYGPYRDAQVVQLPVKDYVQT: 203
SecStr          :EE    TT EEEEEEEETTEEEEEEEEE  TTS B     TT TT EEEEEETTEEEEEEEEEEE TTS EEEE TTS BSTT  SSSS        B H:    
ExpBur          :eebebeebebbbbbbbbebeeeeeebbbbbebebbeeebeeebbbbbbbeeeeebbebbbbbbbebeeebbbbbbbebebbeebebbeeebeeeeeeebb:    

queryA      3465:VNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCS:3564
                :*** ******  *   **         ***  **         * *  *  *   **       *  * *   *  ** ****   ***  * **  *  :
3d23_C_1     204:VNVIAWLYAAILNNCAWFVQNDVCSTEDFNVWAMANGFSQVKADLV--LDALASMTGVSIETLLAAIKRLYM-GFQGRQILGSCTFEDELAPSDVYQQLA: 300
SecStr          :HHHHHHHHHHHHTT  TT  S    HHHHHHHHHHHTB      HH--HHHHHHHHS  HHHHHHHHHHHTT-  TT  SSS SS   SS HHHHHHHHT:    
ExpBur          :bbbbbbbbbbbeeebeebeeeeebeeeebbeebeeeebbebeeeee--beebbeeeebebebbbbbbeebee-ebeeeebeeeeebebbbbbebbeeeee:    
Contact         :                      b                                                                             

queryA      3565:G:3565
                :*:
3d23_C_1     301:G: 301
SecStr          : :    
ExpBur          :e:    


Input Residue Numbers for Focused Sites

ex) 2,15,123